PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A07G2031
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 210aa    MW: 24370.3 Da    PI: 6.9107
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A07G2031genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.31.5e-171562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l+++++ +G g W++ ar  g++Rt+k+c++rw++yl
      Gh_A07G2031 15 KGPWTMEEDLILINYIANHGEGVWNSLARAAGLKRTGKSCRLRWLNYL 62
                     79********************************************97 PP

2Myb_DNA-binding54.23.4e-1768111146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE+ l+ ++++++G++ W++Ia++++ gRt++++k++w++
      Gh_A07G2031  68 RGNITPEEQFLIMELHAKWGNR-WSKIAKHLP-GRTDNEIKNYWRT 111
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-23765IPR009057Homeodomain-like
PROSITE profilePS5129415.2621062IPR017930Myb domain
SuperFamilySSF466892.02E-3013109IPR009057Homeodomain-like
SMARTSM007179.3E-131464IPR001005SANT/Myb domain
PfamPF002495.8E-161562IPR001005SANT/Myb domain
CDDcd001677.56E-101762No hitNo description
PROSITE profilePS5129424.33663117IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.9E-2566117IPR009057Homeodomain-like
SMARTSM007174.9E-1567115IPR001005SANT/Myb domain
PfamPF002495.8E-1668111IPR001005SANT/Myb domain
CDDcd001677.08E-1272111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0080086Biological Processstamen filament development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MDKKPCKSQE VEVRKGPWTM EEDLILINYI ANHGEGVWNS LARAAGLKRT GKSCRLRWLN  60
YLRPDVRRGN ITPEEQFLIM ELHAKWGNRW SKIAKHLPGR TDNEIKNYWR TRIQKHMNKP  120
AEVCYSNQSD CELLDQQASS SQLPCNSTNT TNADLMGTSY SPLSSFDYYN NIEAFSGQQQ  180
QQVMLESPSS QEDNYWNMED IWSMQILNGN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-251211524126MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.225370.0boll| ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9234740.0JQ923474.1 Gossypium hirsutum MYB24 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012444424.11e-144PREDICTED: myb-related protein 340 isoform X1
SwissprotP813918e-93MYB05_ANTMA; Myb-related protein 305
TrEMBLR9QBI01e-157R9QBI0_G
STRINGVIT_14s0066g01090.t017e-93(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40350.12e-87myb domain protein 24
Publications ? help Back to Top
  1. Li Y, et al.
    A cotton gene encoding MYB-like transcription factor is specifically expressed in pollen and is involved in regulation of late anther/pollen development.
    Plant Cell Physiol., 2013. 54(6): p. 893-906
    [PMID:23447105]